PDB entry 2hwo

View 2hwo on RCSB PDB site
Description: Crystal structure of Src kinase domain in complex with covalent inhibitor
Class: transferase
Keywords: kinase, covalent, quinazoline, modification, transferase
Deposited on 2006-08-01, released 2007-02-27
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.238
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (97)
    Domains in SCOPe 2.03: d2hwoa_
  • Chain 'B':
    Compound: Proto-oncogene tyrosine-protein kinase Src
    Species: Gallus gallus [TaxId:9031]
    Gene: SRC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00523 (Start-285)
      • engineered (97)
    Domains in SCOPe 2.03: d2hwob_
  • Heterogens: RBS, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hwoA (A:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwoA (A:)
    lakdaweipreslrlevklggcfgevwmgtwngttrvaiktlkpflqeaqvmkklrhekl
    vqlyavvspiyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvh
    rdlraanilvgenlvckvadfgpikwtapeaalygrftiksdvwsfgilltelttkgrvp
    ypgmvnrevldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyfts
    tepqyqpgenl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hwoB (B:)
    ghmqtqglakdaweipreslrlevklgqgcfgevwmgtwngttrvaiktlkpgtmspeaf
    lqeaqvmkklrheklvqlyavvseepiyivteymskgclldflkgemgkylrlpqlvdma
    aqiasgmayvermnyvhrdlraanilvgenlvckvadfglarliedneytarqgakfpik
    wtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrevldqvergyrmpcppec
    peslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpgenl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hwoB (B:)
    daweipreslrlevklgqggevwmgtwngttrvaiktlkqvmkklrheklvqlyavvsee
    piyivteymskgclldflkgemgkylrlpqlvdmaaqiasgmayvermnyvhrdlraani
    lvgenlvckvadfpikwtapeaalygrftiksdvwsfgilltelttkgrvpypgmvnrev
    ldqvergyrmpcppecpeslhdlmcqcwrkdpeerptfeylqafledyftstepqyqpge
    nl