PDB entry 2hwn
View 2hwn on RCSB PDB site
Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide
Class: transferase
Keywords: PKA, AKAP, Dimerization/Docking, D/D, Regulatory Subunit, TRANSFERASE
Deposited on
2006-08-01, released
2006-11-21
The last revision prior to the SCOPe 2.01 freeze date was dated
2011-07-13, with a file datestamp of
2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.208
AEROSPACI score: 0.59
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
Species: Rattus norvegicus [TaxId:10116]
Gene: Prkar2a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2hwna_ - Chain 'B':
Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
Species: Rattus norvegicus [TaxId:10116]
Gene: Prkar2a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2hwnb_ - Chain 'C':
Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
Species: Rattus norvegicus [TaxId:10116]
Gene: Prkar2a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2hwnc_ - Chain 'D':
Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
Species: Rattus norvegicus [TaxId:10116]
Gene: Prkar2a
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.01: d2hwnd_ - Chain 'E':
Compound: A Kinase binding peptide
Database cross-references and differences (RAF-indexed):
- Chain 'F':
Compound: A Kinase binding peptide
Database cross-references and differences (RAF-indexed):
- Heterogens: GOL, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2hwnA (A:)
mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Sequence, based on observed residues (ATOM records): (download)
>2hwnA (A:)
ippgltellqgytvevlrqqppdlvdfaveyftrlrear
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2hwnB (B:)
mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
- Chain 'C':
Sequence, based on SEQRES records: (download)
>2hwnC (C:)
mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Sequence, based on observed residues (ATOM records): (download)
>2hwnC (C:)
qippgltellqgytvevlrqqppdlvdfaveyftrlrear
- Chain 'D':
Sequence, based on SEQRES records: (download)
>2hwnD (D:)
mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
Sequence, based on observed residues (ATOM records): (download)
>2hwnD (D:)
shiqippgltellqgytvevlrqqppdlvdfaveyftrlrear
- Chain 'E':
No sequence available.
- Chain 'F':
No sequence available.