PDB entry 2hwn

View 2hwn on RCSB PDB site
Description: Crystal Structure of RII alpha Dimerization/Docking domain of PKA bound to the D-AKAP2 peptide
Class: transferase
Keywords: PKA, AKAP, Dimerization/Docking, D/D, Regulatory Subunit, TRANSFERASE
Deposited on 2006-08-01, released 2006-11-21
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.208
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Prkar2a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12368
  Domains in SCOPe 2.01: d2hwna_
• Chain 'B':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Prkar2a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12368 (0-44)
  Domains in SCOPe 2.01: d2hwnb_
• Chain 'C':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Prkar2a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12368
  Domains in SCOPe 2.01: d2hwnc_
• Chain 'D':
  Compound: cAMP-dependent protein kinase type II-alpha regulatory subunit
  Species: Rattus norvegicus [TaxId:10116]
  Gene: Prkar2a
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12368
  Domains in SCOPe 2.01: d2hwnd_
• Chain 'E':
  Compound: A Kinase binding peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 2HWN
• Chain 'F':
  Compound: A Kinase binding peptide
  Database cross-references and differences (RAF-indexed):
  • PDB 2HWN
• Heterogens: GOL, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hwnA (A:)
  mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hwnA (A:)
  ippgltellqgytvevlrqqppdlvdfaveyftrlrear
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hwnB (B:)
  mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
  

  
  
• Chain 'C':
  Sequence, based on SEQRES records: (download)
  

  >2hwnC (C:)
  mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hwnC (C:)
  qippgltellqgytvevlrqqppdlvdfaveyftrlrear
  

  
  
• Chain 'D':
  Sequence, based on SEQRES records: (download)
  

  >2hwnD (D:)
  mshiqippgltellqgytvevlrqqppdlvdfaveyftrlrearr
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hwnD (D:)
  shiqippgltellqgytvevlrqqppdlvdfaveyftrlrear
  

  
  
• Chain 'E':
  No sequence available.
  
  
• Chain 'F':
  No sequence available.