PDB entry 2hvp

View 2hvp on RCSB PDB site
Description: three-dimensional structure of aspartyl protease from human immunodeficiency virus hiv-1
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1989-04-10, released 1989-04-19
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: -
Resolution: 3 Å
R-factor: 0.37
AEROSPACI score: -0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hvpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hvpA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

    Sequence, based on observed residues (ATOM records): (download) 
    >2hvpA (A:)
wqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqydqilie
icghkaigtvlvgptpvniigrnlltqigctlnf