PDB entry 2hvp

View 2hvp on RCSB PDB site
Description: three-dimensional structure of aspartyl protease from human immunodeficiency virus hiv-1
Deposited on 1989-04-10, released 1989-04-19
The last revision prior to the SCOP 1.55 freeze date was dated 1989-10-15, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 3 Å
R-factor: 0.37
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2hvp__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hvp_ (-)
  wqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqydqilie
  icghkaigtvlvgptpvniigrnlltqigctlnf