PDB entry 2hvp

View 2hvp on RCSB PDB site
Description: three-dimensional structure of aspartyl protease from human immunodeficiency virus hiv-1
Class: hydrolase(acid proteinase)
Keywords: hydrolase(acid proteinase)
Deposited on 1989-04-10, released 1989-04-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: N/A
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hiv-1 protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hvpa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hvpA (A:)
pqitlwqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrnlltqigctlnf

    Sequence, based on observed residues (ATOM records): (download) 
    >2hvpA (A:)
wqrplvtikiggqlkealldtgaddtvleemnlpgrwkpkmiggiggfikvrqydqilie
icghkaigtvlvgptpvniigrnlltqigctlnf