PDB entry 2hvm

View 2hvm on RCSB PDB site
Description: hevamine a at 1.8 angstrom resolution
Deposited on 1996-07-02, released 1997-01-11
The last revision prior to the SCOP 1.57 freeze date was dated 1997-01-11, with a file datestamp of 1997-01-13.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.149
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2hvm__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvm_ (-)
    ggiaiywgqngnegtltqtcstrkysyvniaflnkfgngqtpqinlaghcnpaaggctiv
    sngirscqiqgikvmlslgggigsytlasqadaknvadylwnnflggksssrplgdavld
    gidfdiehgstlywddlarylsayskqgkkvyltaapqcpfpdrylgtalntglfdyvwv
    qfynnppcqyssgninniinswnrwttsinagkiflglpaapeaagsgyvppdvlisril
    peikkspkyggvmlwskfyddkngysssildsv