PDB entry 2hvh

View 2hvh on RCSB PDB site
Description: ddCTP:O6MeG pair in the polymerase active site (0 position)
Class: Transferase/DNA
Keywords: DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine, Transferase/DNA COMPLEX
Deposited on 2006-07-28, released 2006-12-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.201
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hvha1, d2hvha2
  • Chain 'B':
    Compound: 5'-d(*cp*cp*tp*gp*ap*cp*tp*cp*(ddg))-3'
  • Chain 'C':
    Compound: 5'-d(*cp*a*tp*(6og)p*cp*gp*ap*gp*tp*cp*ap*gp*g)-3'
  • Chain 'D':
    Compound: DNA polymerase I
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hvhd1, d2hvhd2
  • Chain 'E':
    Compound: 5'-d(*cp*cp*tp*gp*ap*cp*tp*cp*(ddg))-3'
  • Chain 'F':
    Compound: 5'-d(*cp*a*tp*(6og)p*cp*gp*ap*gp*tp*cp*ap*gp*g)-3'
  • Heterogens: SUC, MN, SO4, DCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvhA (A:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    patkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnygivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hvhD (D:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    patkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnygivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.