PDB entry 2hv8

View 2hv8 on RCSB PDB site
Description: Crystal structure of GTP-bound Rab11 in complex with FIP3
Class: protein transport
Keywords: Protein transport, Rab11a, FIP3, cytokinesis, recycling endosomes
Deposited on 2006-07-27, released 2006-11-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.86 Å
R-factor: 0.205
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (Start-171)
      • engineered (66)
    Domains in SCOPe 2.04: d2hv8a_
  • Chain 'B':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (Start-171)
      • engineered (66)
    Domains in SCOPe 2.04: d2hv8b_
  • Chain 'C':
    Compound: Ras-related protein Rab-11A
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11a
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62491 (Start-171)
      • engineered (66)
    Domains in SCOPe 2.04: d2hv8c_
  • Chain 'D':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11FIP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hv8d1
  • Chain 'E':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11FIP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hv8e_
  • Chain 'F':
    Compound: Rab11 family-interacting protein 3
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB11FIP3
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hv8f_
  • Heterogens: 2ME, MG, SO4, GTP, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hv8A (A:)
    gsdeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq
    iwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvg
    nksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv8A (A:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hv8B (B:)
    gsdeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq
    iwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvg
    nksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv8B (B:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hv8C (C:)
    gsdeydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaq
    iwdtagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvg
    nksdlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv8C (C:)
    eydylfkvvligdsgvgksnllsrftrnefnleskstigvefatrsiqvdgktikaqiwd
    tagleryraitsayyrgavgallvydiakhltyenverwlkelrdhadsnivimlvgnks
    dlrhlravptdearafaeknglsfietsaldstnveaafqtilteiyri
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hv8D (D:)
    gsgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsi
    levk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv8D (D:)
    afseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hv8E (E:)
    gsgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsi
    levk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv8E (E:)
    tafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hv8F (F:)
    gsgakslfstafseslaaeissvsrdelmeaiqkqeeinfrlqdyidriivaimetnpsi
    levk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hv8F (F:)
    srdelmeaiqkqeeinfrlqdyidriivaimetnpsilevk