PDB entry 2huy

View 2huy on RCSB PDB site
Description: X-ray crystal structure of the complex between the Grb2-SH2 domain and a flexible ligand, fpYVN.
Class: hormone/growth factor
Keywords: Flexible, constrained, entropy, Grb2-SH2, ligand preorganization, HORMONE/GROWTH FACTOR COMPLEX
Deposited on 2006-07-27, released 2006-08-15
The last revision prior to the SCOPe 2.08 freeze date was dated 2008-08-12, with a file datestamp of 2008-08-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.207
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Growth factor receptor-bound protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: GRB2, ASH
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2huya_
  • Heterogens: YVN, FMT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2huyA (A:)
iemkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlr
dgagkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvpqqptyvqhhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2huyA (A:)
mkphpwffgkiprakaeemlskqrhdgafliresesapgdfslsvkfgndvqhfkvlrdg
agkyflwvvkfnslnelvdyhrstsvsrnqqiflrdieqvp