PDB entry 2hts

View 2hts on RCSB PDB site
Description: crystal structure of the dna binding domain of the heat shock transcription factor
Deposited on 1994-06-02, released 1995-02-07
The last revision prior to the SCOP 1.69 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: -
Resolution: 1.83 Å
R-factor: 0.187
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.69: d2hts__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hts_ (-)
  arpafvnklwsmvndksnekfihwstsgesivvpnrerfvqevlpkyfkhsnfasfvrql
  nmygwhkvqdvksgsndsrwefenerha