PDB entry 2htk

View 2htk on RCSB PDB site
Description: Structure of the Escherichia coli ClC chloride channel Y445A mutant and Fab complex
Class: membrane protein
Keywords: ClC family of channel and transporters, H+/Cl- antiporter, membrane protein, Fab complex
Deposited on 2006-07-26, released 2006-09-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3.41 Å
R-factor: 0.266
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (444)
  • Chain 'B':
    Compound: H(+)/Cl(-) exchange transporter clcA
    Species: Escherichia coli
    Gene: clcA, eriC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37019
      • engineered (444)
  • Chain 'C':
    Compound: Fab fragment, heavy chain
    Species: MUS MUSCULUS
  • Chain 'D':
    Compound: Fab fragment, light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d2htkd1, d2htkd2
  • Chain 'E':
    Compound: Fab fragment, heavy chain
    Species: MUS MUSCULUS
  • Chain 'F':
    Compound: Fab fragment, light chain
    Species: MUS MUSCULUS
    Domains in SCOP 1.73: d2htkf1, d2htkf2
  • Heterogens: BR

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2htkD (D:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2htkF (F:)
    divltqspaimsaapgdkvtmtcsasssvsyihwyqqksgtspkrwiydtskltsgvpvr
    fsgsgsgtsysltintmeaedaatyycqqwsshpqtfgggtkleilradaaptvsifpps
    seqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstltl
    tkdeyerhnsytceathktstspivksfnra