PDB entry 2ht0

View 2ht0 on RCSB PDB site
Description: IHF bound to doubly nicked DNA
Class: transcription/DNA
Keywords: DNA bending, kink, nick, protein-DNA complex, TRANSCRIPTION/DNA COMPLEX
Deposited on 2006-07-24, released 2006-11-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.235
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integration host factor alpha-subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ht0a_
  • Chain 'B':
    Compound: Integration host factor beta-subunit
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2ht0b_
  • Chain 'C':
    Compound: 5'-d(*cp*gp*gp*tp*gp*cp*ap*ap*cp*ap*ap*ap*t)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*gp*ap*tp*ap*ap*gp*cp*ap*ap*tp*gp*cp*tp*tp*tp*tp*tp*tp*gp*gp*c)-3'
  • Chain 'E':
    Compound: 5'-d(*gp*gp*cp*cp*ap*ap*ap*ap*ap*ap*gp*cp*ap*tp*t)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*cp*tp*tp*ap*tp*cp*ap*ap*tp*tp*tp*gp*tp*tp*gp*cp*ap*cp*c)-3'
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ht0A (A:)
    maltkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqr
    pgrnpktgedipitarrvvtfrpgqklksrvenaspkde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ht0A (A:)
    altkaemseylfdklglskrdakelvelffeeirralengeqvklsgfgnfdlrdknqrp
    grnpktgedipitarrvvtfrpgqklksrvenaspk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ht0B (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ht0B (B:)
    mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
    grnpktgdkvelegkyvphfkpgkelrdraniy
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.