PDB entry 2hsm

View 2hsm on RCSB PDB site
Description: Structural basis of yeast aminoacyl-tRNA synthetase complex formation revealed by crystal structures of two binary sub-complexes
Class: Ligase/RNA Binding Protein
Keywords: protein complex protein interaction GST-fold
Deposited on 2006-07-22, released 2006-09-05
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.198
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutamyl-tRNA synthetase, cytoplasmic
    Species: Saccharomyces cerevisiae
    Gene: GUS1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hsmb1

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hsmB (B:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    hd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hsmB (B:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    h