PDB entry 2hsh

View 2hsh on RCSB PDB site
Description: Crystal structure of C73S mutant of human thioredoxin-1 oxidized with H2O2
Class: oxidoreductase
Keywords: mutant, OXIDOREDUCTASE
Deposited on 2006-07-21, released 2006-12-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.35 Å
R-factor: 0.125
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thioredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: TXN
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5T937 (0-104)
      • engineered (72)
    Domains in SCOPe 2.06: d2hsha_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hshA (A:)
    mvkqiesktafqealdaagdklvvvdfsatwcgpckmikpffhslsekysnviflevdvd
    dcqdvasecevksmptfqffkkgqkvgefsgankekleatinelv