PDB entry 2hs2

View 2hs2 on RCSB PDB site
Description: Crystal structure of M46L mutant of HIV-1 protease complexed with TMC114 (darunavir)
Class: hydrolase
Keywords: aspartic protease active site surface binding site, HYDROLASE
Deposited on 2006-07-20, released 2006-10-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.22 Å
R-factor: 0.142
AEROSPACI score: 0.83 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368
      • engineered (6)
      • engineered (32)
      • engineered (45)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d2hs2a_
  • Chain 'B':
    Compound: Protease
    Species: Human immunodeficiency virus 1 [TaxId:11676]
    Gene: GAG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03368 (0-98)
      • engineered (6)
      • engineered (32)
      • engineered (45)
      • engineered (62)
      • engineered (66)
      • engineered (94)
    Domains in SCOPe 2.07: d2hs2b_
  • Heterogens: CL, 017, DMS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hs2A (A:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkliggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hs2B (B:)
    pqitlwkrplvtikiggqlkealldtgaddtvieemslpgrwkpkliggiggfikvrqyd
    qiiieiaghkaigtvlvgptpvniigrnlltqigatlnf