PDB entry 2hrp

View 2hrp on RCSB PDB site
Description:
Deposited on 1996-12-27, released 1997-12-31
The last revision prior to the SCOP 1.57 freeze date was dated 1997-12-31, with a file datestamp of 1997-12-31.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.198
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d2hrph1, d2hrph2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d2hrpl1, d2hrpl2
  • Chain 'M':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d2hrpm1, d2hrpm2
  • Chain 'N':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.57: d2hrpn1, d2hrpn2

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpH (H:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivprd
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpL (L:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnr
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpM (M:)
    dtvltqspaslavslgqratiscrasesvdyygksfmnwfqqkpgqppklliyaasnqgs
    gvparfsgsgsgtdfslhihpmeeddsamyfcqqskevpwtfgggtkleikradaaptvs
    ifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysms
    stltltkdeyerhnsytceathktstspivksfnrnec
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hrpN (N:)
    dvqlvesggglvqpggsrklscaasgftfmrfgmhwvrqapekglewvayissgsstiyy
    adtvkgrftisrdnpkntlflqmtslrsedtalyycarsggierydgtyyvmdywgqgts
    vtvssakttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpa
    vlqsdlytlsssvtvpssprpsetvtcnvahpasstkvdkkivp