PDB entry 2hr1

View 2hr1 on RCSB PDB site
Description: Ternary structure of WT M.HhaI C5-Cytosine DNA methyltransferase with unmodified DNA and AdoHcy
Class: Transferase/DNA
Keywords: High resolution, M.HhaI, Transferase/DNA COMPLEX
Deposited on 2006-07-19, released 2006-09-19
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.96 Å
R-factor: 0.238
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: modification methylase hhai
    Species: Haemophilus parahaemolyticus [TaxId:735]
    Gene: hhaIM
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2hr1a_
  • Chain 'C':
    Compound: 5'-d(*gp*ap*tp*ap*gp*cp*gp*cp*tp*ap*tp*c)-3'
  • Chain 'D':
    Compound: 5'-d(*tp*gp*ap*tp*ap*gp*cp*gp*cp*tp*ap*tp*c)-3'
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2hr1A (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.