PDB entry 2hqt

View 2hqt on RCSB PDB site
Description: Crystal structures of the interacting domains from yeast glutamyl-tRNA synthetase and tRNA aminoacylation and nuclear export cofactor Arc1p reveal a novel function for an old fold
Class: biosynthetic protein, RNA binding
Keywords: GST-fold, BIOSYNTHETIC PROTEIN, RNA BINDING
Deposited on 2006-07-19, released 2006-09-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.212
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqta1
  • Chain 'B':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtb_
  • Chain 'C':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtc_
  • Chain 'D':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtd_
  • Chain 'E':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqte_
  • Chain 'F':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46672 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.01: d2hqtf_
  • Chain 'G':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtg_
  • Chain 'H':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqth_
  • Chain 'I':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqti_
  • Chain 'J':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P46672 (2-End)
      • cloning artifact (1)
    Domains in SCOPe 2.01: d2hqtj_
  • Chain 'K':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtk_
  • Chain 'L':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtl_
  • Chain 'M':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtm_
  • Chain 'N':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtn_
  • Chain 'O':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqto_
  • Chain 'P':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtp_
  • Chain 'Q':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtq_
  • Chain 'R':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtr_
  • Chain 'S':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqts_
  • Chain 'T':
    Compound: GU4 nucleic-binding protein 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ARC1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2hqtt_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hqtA (A:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtA (A:)
    sdlvtkfesliypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstlypt
    stdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hqtB (B:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtB (B:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hqtC (C:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtC (C:)
    dlvtkfesliisksftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstlypts
    tdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hqtD (D:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtD (D:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hqtE (E:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtE (E:)
    sdlvtkfesliypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstlypt
    stdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hqtF (F:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtF (F:)
    hmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivs
    tlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hqtG (G:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtG (G:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hqtH (H:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtH (H:)
    sdlvtkfesliiskypvsfaqwesvlksgqiqphldqlnlvlrdntfivstlyptstdvh
    vfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2hqtI (I:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtI (I:)
    msdlvtkfesliypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstlyp
    tstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2hqtJ (J:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtJ (J:)
    hmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivs
    tlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    n
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2hqtK (K:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtK (K:)
    sdlvtkfesliiskypsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstly
    ptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hqtL (L:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtL (L:)
    sdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstl
    yptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2hqtM (M:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtM (M:)
    msdlvtkfesliiypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstly
    ptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2hqtN (N:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtN (N:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2hqtO (O:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtO (O:)
    sdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstl
    yptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2hqtP (P:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtP (P:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2hqtQ (Q:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtQ (Q:)
    msdlvtkfesliiypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstly
    ptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2hqtR (R:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtR (R:)
    sdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstl
    yptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2hqtS (S:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtS (S:)
    dlvtkfesliiskypsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivstlyp
    tstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklei
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2hqtT (T:)
    ghmsdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfiv
    stlyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdkle
    inhd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqtT (T:)
    msdlvtkfesliiskypvsftkeqsaqaaqwesvlksgqiqphldqlnlvlrdntfivst
    lyptstdvhvfevalplikdlvasskdvkstyttyrhilrwidymqnllevsstdklein
    h