PDB entry 2hqo

View 2hqo on RCSB PDB site
Description: Structure of a Atypical Orphan Response Regulator Protein Revealed a New Phosphorylation-Independent Regulatory Mechanism
Class: signaling protein
Keywords: Phosporylation-Independent Response Regulator, regulatory domain, symmetric dimer, SIGNALING PROTEIN
Deposited on 2006-07-19, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative transcriptional regulator
    Species: Helicobacter pylori [TaxId:85963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hqoa_
  • Chain 'B':
    Compound: Putative transcriptional regulator
    Species: Helicobacter pylori [TaxId:85963]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hqob_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hqoA (A:)
    mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
    rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwgsnl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqoA (A:)
    mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
    rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwgsn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hqoB (B:)
    mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
    rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwgsnl
    vpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hqoB (B:)
    mrvllieknsvlggeiekglnvkgfmadvtesledgeylmdirnydlvmvsdknalsfvs
    rikekhssivvlvssdnptseeevhafeqgaddyiakpyrsikalvariearlrfwgsn