PDB entry 2hq8

View 2hq8 on RCSB PDB site
Description: Crystal structure of coelenterazine-binding protein from renilla muelleri in the ca loaded apo form
Class: structural genomics, unknown function
Keywords: COELENTERAZINE-BINDING PROTEIN, RENILLA MUELLERI, PSI, STRUCTURAL GENOMICS, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, Protein Structure Initiative, SECSG, UNKNOWN FUNCTION
Deposited on 2006-07-18, released 2006-09-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.207
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Coelenterazine-binding protein ca-bound apo form
    Species: Renilla muelleri [TaxId:37510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hq8a_
  • Chain 'B':
    Compound: Coelenterazine-binding protein ca-bound apo form
    Species: Renilla muelleri [TaxId:37510]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hq8b_
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hq8A (A:)
    mpeiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqe
    flrvadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvs
    lpefkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanaf
    ygdlvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq8A (A:)
    iteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqeflr
    vadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslpe
    fkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanafygd
    l
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hq8B (B:)
    mpeiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqe
    flrvadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvs
    lpefkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanaf
    ygdlvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hq8B (B:)
    iteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqeflr
    vadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslpe
    fkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanafygd
    lv