PDB entry 2hps

View 2hps on RCSB PDB site
Description: Crystal structure of coelenterazine-binding protein from Renilla Muelleri
Class: luminescent protein
Keywords: bioluminescence, coelenterazine-binding, Southeast Collaboratory for Structural Genomics, SECSG, Structural Genomics, PSI, Protein Structure Initiative, LUMINESCENT PROTEIN
Deposited on 2006-07-17, released 2007-01-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.72 Å
R-factor: 0.2
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coelenterazine-binding protein with bound coelenterazine
    Species: Renilla muelleri [TaxId:37510]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2HPS (Start-185)
    Domains in SCOPe 2.06: d2hpsa_
  • Heterogens: CTZ, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hpsA (A:)
    mpeiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqe
    flrvadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvs
    lpefkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanaf
    ygdlvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hpsA (A:)
    eiteserayhlrkmktrmqrvdvtgdgfisredyeliavriakiaklsaekaeetrqefl
    rvadqlglapgvrisveeaavnatdsllkmkgeekamaviqslimydcidtdkdgyvslp
    efkaflqavgpdltddkaitcfntldfnkngqisrdeflvtvndflfgleetalanafyg
    dlvd