PDB entry 2hpa

View 2hpa on RCSB PDB site
Description: structural origins of l(+)-tartrate inhibition of human prostatic acid phosphatase
Deposited on 1998-09-11, released 1998-09-16
The last revision prior to the SCOP 1.71 freeze date was dated 2000-01-14, with a file datestamp of 2000-01-13.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.211
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d2hpaa_
  • Chain 'B':
    Domains in SCOP 1.71: d2hpab_
  • Chain 'C':
    Domains in SCOP 1.71: d2hpac_
  • Chain 'D':
    Domains in SCOP 1.71: d2hpad_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpaA (A:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpaB (B:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpaC (C:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hpaD (D:)
    kelkfvtlvfrhgdrspidtfptdpikesswpqgfgqltqlgmeqhyelgeyirkryrkf
    lnesykheqvyirstdvdrtlmsamtnlaalfppegvsiwnpillwqpipvhtvplsedq
    llylpfrncprfqelesetlkseefqkrlhpykdfiatlgklsglhgqdlfgiwskvydp
    lycesvhnftlpswatedtmtklrelselsllslygihkqkeksrlqggvlvneilnhmk
    ratqipsykklimysahdttvsglqmaldvyngllppyaschltelyfekgeyfvemyyr
    netqhepyplmlpgcspscplerfaelvgpvipqdwstecmt