PDB entry 2hmn

View 2hmn on RCSB PDB site
Description: Crystal Structure of the Naphthalene 1,2-Dioxygenase F352V Mutant Bound to Anthracene.
Class: Oxidoreductase
Keywords: Oxidoreductase, Protien, Rieske Oxygenase
Deposited on 2006-07-11, released 2006-10-10
The last revision prior to the SCOP 1.73 freeze date was dated 2006-10-10, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.161
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Naphthalene 1,2-dioxygenase alpha subunit
    Species: PSEUDOMONAS SP.
    Gene: doxB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A111 (0-End)
      • engineered (351)
    Domains in SCOP 1.73: d2hmna1, d2hmna2
  • Chain 'B':
    Compound: Naphthalene 1,2-dioxygenase beta subunit
    Species: PSEUDOMONAS SP.
    Gene: doxD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2hmnb1
  • Heterogens: FE, SO4, FES, AN3, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hmnA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtvgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkttdr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmnA (A:)
    mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
    idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
    kdlygeslnkkclglkevarvesfhgfiygcfdqeapplmdylgdaawylepmfkhsggl
    elvgppgkvvikanwkapaenfvgdayhvgwthasslrsgesifsslagnaalppegagl
    qmtskygsgmgvlwdgysgvhsadlvpelmafggakqerlnkeigdvrariyrshlnctv
    fpnnsmltcsgvfkvwnpidanttevwtyaivekdmpedlkrrladsvqrtvgpagfwes
    ddndnmetasqngkkyqsrdsdllsnlgfgedvygdavypgvvgksaigetsyrgfyray
    qahvsssnwaefehasstwhteltkt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hmnB (B:)
    mminiqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgs
    evqyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfi
    tnvqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdy
    perilqthnlmvfl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmnB (B:)
    iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
    qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
    vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
    rilqthnlmvfl