PDB entry 2hmb

View 2hmb on RCSB PDB site
Description: three-dimensional structure of recombinant human muscle fatty acid-binding protein
Class: lipid-binding protein
Keywords: lipid-binding protein
Deposited on 1992-09-11, released 1994-01-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: muscle fatty acid binding protein
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hmba_
  • Heterogens: PLM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hmbA (A:)
    vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
    eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
    tavctrtyekea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hmbA (A:)
    vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
    eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
    tavctrtyeke