PDB entry 2hmb

View 2hmb on RCSB PDB site
Description: three-dimensional structure of recombinant human muscle fatty acid- binding protein
Deposited on 1992-09-11, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.1 Å
R-factor: 0.195
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d2hmb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hmb_ (-)
  vdaflgtwklvdsknfddymkslgvgfatrqvasmtkpttiiekngdiltlkthstfknt
  eisfklgvefdettaddrkvksivtldggklvhlqkwdgqettlvrelidgkliltlthg
  tavctrtyeke