PDB entry 2hld

View 2hld on RCSB PDB site
Description: Crystal structure of yeast mitochondrial F1-ATPase
Class: hydrolase
Keywords: ATP phosphorylase (h+ transporting), ATP synthase, f1fo, f1-ATPase, hydrolase
Deposited on 2006-07-06, released 2006-11-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.207
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '1':
    Compound: ATP synthase epsilon chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hld1_
  • Chain 'A':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hlda1, d2hlda2, d2hlda3
  • Chain 'B':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldb1, d2hldb2, d2hldb3
  • Chain 'C':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldc1, d2hldc2, d2hldc3
  • Chain 'D':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldd1, d2hldd2, d2hldd3
  • Chain 'E':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hlde1, d2hlde2, d2hlde3
  • Chain 'F':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldf1, d2hldf2, d2hldf3
  • Chain 'G':
    Compound: ATP synthase gamma chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldg_
  • Chain 'H':
    Compound: ATP synthase delta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldh1, d2hldh2
  • Chain 'I':
    Compound: ATP synthase epsilon chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldi_
  • Chain 'J':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldj1, d2hldj2, d2hldj3
  • Chain 'K':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldk1, d2hldk2, d2hldk3
  • Chain 'L':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldl1, d2hldl2, d2hldl3
  • Chain 'M':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldm1, d2hldm2, d2hldm3
  • Chain 'N':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldn1, d2hldn2, d2hldn3
  • Chain 'O':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldo1, d2hldo2, d2hldo3
  • Chain 'P':
    Compound: ATP synthase gamma chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldp_
  • Chain 'Q':
    Compound: ATP synthase delta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldq1, d2hldq2
  • Chain 'R':
    Compound: ATP synthase epsilon chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldr_
  • Chain 'S':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hlds1, d2hlds2, d2hlds3
  • Chain 'T':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldt1, d2hldt2, d2hldt3
  • Chain 'U':
    Compound: ATP synthase alpha chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldu1, d2hldu2, d2hldu3
  • Chain 'V':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldv1, d2hldv2, d2hldv3
  • Chain 'W':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldw1, d2hldw2, d2hldw3
  • Chain 'X':
    Compound: ATP synthase beta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: ATP2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldx1, d2hldx2, d2hldx3
  • Chain 'Y':
    Compound: ATP synthase gamma chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldy_
  • Chain 'Z':
    Compound: ATP synthase delta chain, mitochondrial
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hldz1
  • Heterogens: MG, PO4, ANP, HOH

PDB Chain Sequences:

  • Chain '1':
    Sequence, based on SEQRES records: (download)
    >2hld1 (1:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hld1 (1:)
    syaaylnvaaqairsvlnrsqtdafyt
    

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hldA (A:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldA (A:)
    nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
    egelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvh
    epvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvy
    vavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkh
    alivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslta
    lpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkal
    kqvagslklflaqyrevaafaqsdldastkqtlvrgerltqllkqnqysplateeqvpli
    yagvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesfv
    at
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hldB (B:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldB (B:)
    anlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlv
    kegelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsv
    hepvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycv
    yvavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngk
    halivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslt
    alpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvka
    lkqvagslklflaqyrevaafaqsdldastkqtlvrgerltqllkqnqysplateeqvpl
    iyagvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesf
    vat
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hldC (C:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldC (C:)
    nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
    egelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvh
    epvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvy
    vavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkh
    alivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslta
    lpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkal
    kqvagslklflaqyrevaafaqfgsdldastkqtlvrgerltqllkqnqysplateeqvp
    liyagvnghldgielsrigefessflsylksnhnellteirekgelskellaslksates
    fvat
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hldD (D:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldD (D:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hldE (E:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldE (E:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hldF (F:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldF (F:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hldG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldG (G:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknk
    elivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllrthpnniklsin
    gigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsekpifnaktieqs
    psfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdnasknagdminry
    silynrtrqavitnelvdiitgass
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hldH (H:)
    aeaaaassglklqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevm
    egsnskkffisggfatvqpdsqlcvtaieafplesfsqeniknllaeakknvsssdarea
    aeaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldH (H:)
    klqfalphetlysevtqvnlpaksgrigvlanhvptveqllpgvvevmegsnskkffisg
    gfatvqpdsqlcvtaieaplesfseniknllaeakknvsssreaaeaaiqvevlenlqsv
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2hldI (I:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldI (I:)
    isyaaylnvaaqairstelqtasvlnrsqtdafytqyknaseptpitk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2hldJ (J:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldJ (J:)
    nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
    egelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvh
    epvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvy
    vavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkh
    alivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslta
    lpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkal
    kqvagslklflaqyrevaafasdldastkqtlvrgerltqllkqnqysplateeqvpliy
    agvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesfva
    t
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2hldK (K:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldK (K:)
    vsdeanlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgs
    drlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilp
    rrsvhepvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskk
    lycvyvavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfr
    dngkhalivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegs
    gsltalpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaa
    qvkalkqvagslklflaqyrevaafaqdldastkqtlvrgerltqllkqnqysplateeq
    vpliyagvnghldgielsrigefessflsylksnhnellteirekgelskellaslksat
    esfvat
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hldL (L:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldL (L:)
    nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
    egelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvh
    epvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvy
    vavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkh
    alivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslta
    lpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkal
    kqvagslklflaqyrevaafaqsdldastkqtlvrgerltqllkqnqysplateeqvpli
    yagvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesfv
    at
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2hldM (M:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldM (M:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2hldN (N:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldN (N:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2hldO (O:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldO (O:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2hldP (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldP (P:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetkke
    livaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmhpiklsingigkdapt
    fqesaliadkllsvmkgtypkisifyndpvssfepsekpifnaktidtdanvprdlfeyt
    lanqmltamaqgyaaeisarrnamdnasknagdminrysilynrtrqavitnelvdiitg
    ass
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2hldQ (Q:)
    aeaaaassglklqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevm
    egsnskkffisggfatvqpdsqlcvtaieafplesfsqeniknllaeakknvsssdarea
    aeaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldQ (Q:)
    lqfalpheqvnlpaksgrigvlanhvptveqllpgvvfisggfatvqpdsqlcvtaieas
    qeniknllaeakqvevlenlqsvl
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2hldR (R:)
    sawrkagisyaaylnvaaqairsslktelqtasvlnrsqtdafytqykngtaaseptpit
    k
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldR (R:)
    yaaylnvaaqairtelqtasvlnrsqtdafytqy
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2hldS (S:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldS (S:)
    lnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvke
    gelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvhe
    pvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvyv
    avgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkha
    livyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgsltal
    pvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkalk
    qvagslklflaqyrevaafaqdldastkqtlvrgerltqllkqnqysplateeqvpliya
    gvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesfvat
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2hldT (T:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldT (T:)
    nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
    egelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvh
    epvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvy
    vavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkh
    alivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslta
    lpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkal
    kqvagslklflaqyrevaafaqdldastkqtlvrgerltqllkqnqysplateeqvpliy
    agvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesfva
    t
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2hldU (U:)
    astkaqptevssileerikgvsdeanlnetgrvlavgdgiarvfglnniqaeelvefssg
    vkgmalnlepgqvgivlfgsdrlvkegelvkrtgnivdvpvgpgllgrvvdalgnpidgk
    gpidaagrsraqvkapgilprrsvhepvqtglkavdalvpigrgqreliigdrqtgktav
    aldtilnqkrwnngsdeskklycvyvavgqkrstvaqlvqtleqhdamkysiivaatase
    aaplqylapftaasigewfrdngkhalivyddlskqavayrqlslllrrppgreaypgdv
    fylhsrlleraaklsekegsgsltalpvietqggdvsayiptnvisitdgqifleaelfy
    kgirpainvglsvsrvgsaaqvkalkqvagslklflaqyrevaafaqfgsdldastkqtl
    vrgerltqllkqnqysplateeqvpliyagvnghldgielsrigefessflsylksnhne
    llteirekgelskellaslksatesfvatf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldU (U:)
    nlnetgrvlavgdgiarvfglnniqaeelvefssgvkgmalnlepgqvgivlfgsdrlvk
    egelvkrtgnivdvpvgpgllgrvvdalgnpidgkgpidaagrsraqvkapgilprrsvh
    epvqtglkavdalvpigrgqreliigdrqtgktavaldtilnqkrwnngsdeskklycvy
    vavgqkrstvaqlvqtleqhdamkysiivaataseaaplqylapftaasigewfrdngkh
    alivyddlskqavayrqlslllrrppgreaypgdvfylhsrlleraaklsekegsgslta
    lpvietqggdvsayiptnvisitdgqifleaelfykgirpainvglsvsrvgsaaqvkal
    kqvagslklflaqyrevaafaqdldastkqtlvrgerltqllkqnqysplateeqvpliy
    agvnghldgielsrigefessflsylksnhnellteirekgelskellaslksatesfva
    t
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2hldV (V:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldV (V:)
    stpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamd
    gteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfa
    eqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvft
    gvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrd
    eegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvt
    svqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgq
    ehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevft
    gipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2hldW (W:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldW (W:)
    pitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdgt
    eglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfaeq
    stsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftgv
    gertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrdee
    gqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvtsv
    qavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqeh
    ydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftgi
    pgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaekla
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2hldX (X:)
    asaaqstpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvr
    tiamdgteglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihad
    ppsfaeqstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahgg
    fsvftgvgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltia
    eyfrdeegqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttk
    kgsvtsvqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrllda
    avvgqehydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfav
    aevftgipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaaean
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldX (X:)
    tpitgkvtavigaivdvhfeqselpailnaleiktpqgklvlevaqhlgentvrtiamdg
    teglvrgekvldtggpisvpvgretlgriinvigepidergpiksklrkpihadppsfae
    qstsaeiletgikvvdllapyarggkiglfggagvgktvfiqelinniakahggfsvftg
    vgertregndlyremketgvinlegeskvalvfgqmneppgararvaltgltiaeyfrde
    egqdvllfidnifrftqagsevsallgripsavgyqptlatdmgllqeritttkkgsvts
    vqavyvpaddltdpapattfahldattvlsrgiselgiypavdpldsksrlldaavvgqe
    hydvaskvqetlqtykslqdiiailgmdelseqdkltverarkiqrflsqpfavaevftg
    ipgklvrlkdtvasfkavlegkydnipehafymvggiedvvakaeklaa
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2hldY (Y:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmdeaeqlfyknaetknl
    dveatetgapkelivaitsdkglcgsihsqlakavrrhlndqpnadivtigdkikmqllr
    thpnniklsingigkdaptfqesaliadkllsvmkagtypkisifyndpvsslsfepsek
    pifnaktieqspsfgkfeidtdanvprdlfeytlanqmltamaqgyaaeisarrnamdna
    sknagdminrysilynrtrqavitnelvdiitgasslg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldY (Y:)
    atlkevemrlksikniekitktmkivastrlskaekakisakkmditsdkglcgsihsql
    akavrrhlndqpnavtigdkikmqllrthpningigkdaptfqesaliadkllsvmkais
    ifyndpvsslsfepseytlanqmltamaqgyaaeisarrnamdnasknagdminrysily
    nrtrqavitnelvdiitgas
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2hldZ (Z:)
    aeaaaassglklqfalphetlysgsevtqvnlpaksgrigvlanhvptveqllpgvvevm
    egsnskkffisggfatvqpdsqlcvtaieafplesfsqeniknllaeakknvsssdarea
    aeaaiqvevlenlqsvlk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hldZ (Z:)
    eaaeaaiqvevlenlqs