PDB entry 2hk5

View 2hk5 on RCSB PDB site
Description: Hck Kinase in Complex with Lck targetted Inhibitor PG-1009247
Class: transferase
Keywords: Hck, Src-family, Kinase Domain, TRANSFERASE
Deposited on 2006-07-03, released 2006-09-05
The last revision prior to the SCOPe 2.06 freeze date was dated 2015-04-15, with a file datestamp of 2015-04-10.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein kinase HCK
    Species: Homo sapiens [TaxId:9606]
    Gene: HCK
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08631 (1-268)
      • expression tag (0)
    Domains in SCOPe 2.06: d2hk5a2, d2hk5a3
  • Heterogens: 1BM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hk5A (A:)
    aqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflae
    anvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqi
    aegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwta
    peainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpee
    lynimmrcwknrpeerptfeyiqsvlddfe
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hk5A (A:)
    aqkpwekdaweipreslklekklgagqfgevwmatynkhtkvavktmkpgsmsveaflae
    anvmktlqhdklvklhavvtkepiyiitefmakgslldflksdegskqplpklidfsaqi
    aegmafieqrnyihrdlraanilvsaslvckiadfglarviedneytaregakfpikwta
    peainfgsftiksdvwsfgillmeivtygripypgmsnpeviralergyrmprpencpee
    lynimmrcwknrpeerptfeyiqsvlddf