PDB entry 2hjr

View 2hjr on RCSB PDB site
Description: Crystal Structure of Cryptosporidium parvum malate dehydrogenase
Class: oxidoreductase
Keywords: malate dehydrogenase, malaria, Cryptosporidium parvum, Structural Genomics, Structural Genomics Consortium, SGC, OXIDOREDUCTASE
Deposited on 2006-06-30, released 2006-08-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.2
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjra1, d2hjra2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrb1, d2hjrb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrc1, d2hjrc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrd1, d2hjrd2
  • Chain 'E':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjre1, d2hjre2
  • Chain 'F':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrf1, d2hjrf2
  • Chain 'G':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrg1, d2hjrg2
  • Chain 'H':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrh1, d2hjrh2
  • Chain 'I':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjri1, d2hjri2
  • Chain 'J':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrj1, d2hjrj2
  • Chain 'K':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrk1, d2hjrk2
  • Chain 'L':
    Compound: malate dehydrogenase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hjrl1, d2hjrl2
  • Heterogens: CIT, APR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hjrA (A:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrA (A:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlks
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hjrB (B:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrB (B:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hjrC (C:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrC (C:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hjrD (D:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrD (D:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2hjrE (E:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrE (E:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlks
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2hjrF (F:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrF (F:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2hjrG (G:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrG (G:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlks
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2hjrH (H:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrH (H:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2hjrI (I:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrI (I:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlks
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2hjrJ (J:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrJ (J:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2hjrK (K:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrK (K:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlks
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2hjrL (L:)
    lkkisykyntvimrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnh
    cmaligspakifgennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgk
    ycpnafvicitnpldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvs
    aivvgghgdemipltssvtiggillsdfveqgkithsqineiikktafgggeivellktg
    safyapaasavamaqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivn
    lsddekslfsksvesiqnlvqdlkslnl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hjrL (L:)
    mrkkisiigagqigstialllgqkdlgdvymfdiiegvpqgkaldlnhcmaligspakif
    gennyeylqnsdvviitagvprkpnmtrsdlltvnakivgsvaenvgkycpnafvicitn
    pldamvyyfkeksgipankvcgmsgvldsarfrcnlsralgvkpsdvsaivvgghgdemi
    pltssvtiggillsdfveqgkithsqineiikktafgggeivellktgsafyapaasava
    maqaylkdsksvlvcstyltgqynvnnlfvgvpvvigkngiedvvivnlsddekslfsks
    vesiqnlvqdlksl