PDB entry 2hj9

View 2hj9 on RCSB PDB site
Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ
Class: signaling protein
Keywords: periplasmic binding protein, per/arnt/simple-minded (pas) fold, autoinducer-2 (ai-2), quorum sensing, histidine sensor kinase, signaling protein
Deposited on 2006-06-30, released 2006-09-26
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.21
AEROSPACI score: -1.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hj9a_
  • Chain 'B':
    Compound: Autoinducer 2-binding periplasmic protein luxP
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hj9b_
  • Chain 'C':
    Compound: Autoinducer 2 sensor kinase/phosphatase luxQ
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P54302 (2-End)
      • see remark 999 (1)
    Domains in SCOPe 2.05: d2hj9c1
  • Chain 'D':
    Compound: Autoinducer 2 sensor kinase/phosphatase luxQ
    Species: Vibrio harveyi [TaxId:669]
    Gene: luxQ
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2hj9d_
  • Heterogens: AI2, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hj9A (A:)
    gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
    asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
    vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
    segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
    dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
    ledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2hj9B (B:)
    gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
    asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
    vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
    segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
    dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
    ledkpvptvysgdfeivtkadsperiealkkrafrysdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hj9B (B:)
    gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
    asfekrlyklninyqlnqvftrslmealksksdyliftldttrhrkfvehvldstntkli
    lqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyfsegyisdvrg
    dtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacstdvalgavdal
    aelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwdledkpvptvy
    sgdfeivtkadsperiealkkrafrysdn
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2hj9C (C:)
    gskqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh
    tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr
    rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy
    nvadvlqrkssdkrldkllvietpivvnavttelclltvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hj9C (C:)
    skqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsht
    pefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrr
    vpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepyn
    vadvlqrllvietpivvnavttelclltvq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2hj9D (D:)
    gskqqtsalihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpsh
    tpefrfltdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvr
    rvpildpstgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepy
    nvadvlqrkssdkrldkllvietpivvnavttelclltvqd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hj9D (D:)
    alihnifdshfaaiqihhdsnsksevirdfytdrdtdvlnffflsidqsdpshtpefrfl
    tdhkgiiwddgnahfygvndlildslanrvsfsnnwyyinvmtsigsrhmlvrrvpildp
    stgevlgfsfnavvldnnfalmeklksesnvdnvvlvansvplansligdepynvadvlq
    llvietpivvnavttelclltvq