PDB entry 2hid

View 2hid on RCSB PDB site
Description: refined nmr structure of phosphocarrier histidine containing protein from bacillus subtilis
Class: phosphotransferase
Keywords: histidine containing protein, phosphotransferase, pts
Deposited on 1996-05-17, released 1996-11-08
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: histidine containing protein
  Species: Bacillus subtilis
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08877 (0-86)
    • engineered (49)
  Domains in SCOP 1.73: d2hida_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hidA (A:)
  aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
  tisasgadendalnaleetmkseglge