PDB entry 2hid

View 2hid on RCSB PDB site
Description: refined nmr structure of phosphocarrier histidine containing protein from bacillus subtilis
Class: phosphotransferase
Keywords: histidine containing protein, phosphotransferase, pts
Deposited on 1996-05-17, released 1996-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: histidine containing protein
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P08877 (0-86)
    • engineered (49)
  Domains in SCOPe 2.08: d2hida_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hidA (A:)
  aqktfkvtadsgiharpatvlvqtaskydadvnleyngktvnlksimgvvslgiakgaei
  tisasgadendalnaleetmkseglge