PDB entry 2hi6

View 2hi6 on RCSB PDB site
Description: Solution NMR structure of UPF0107 protein AF_0055, Northeast Structural Genomics Consortium Target GR101
Class: structural genomics, unknown function
Keywords: UPF0107 protein AF_0055GFT, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2006-06-29, released 2006-08-29
The last revision prior to the SCOP 1.75 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UPF0107 protein AF0055
    Species: Archaeoglobus fulgidus
    Database cross-references and differences (RAF-indexed):
    • Uniprot O30181 (1-132)
      • cloning artifact (1)
    Domains in SCOP 1.75: d2hi6a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2hi6A (A:)
mvkfacraitrgraegealvtkeyisflggidketgivkedceikgesvagrilvfpggk
gstvgsyvllnlrkngvapkaiinkktetiiavgaamaeiplvevrdekffeavktgdrv
vvnadegyvelielehhhhhh

    Sequence, based on observed residues (ATOM records): (download) 
    >2hi6A (A:)
vkfacraitrgraegealvtkeyisflggidketgivkedceikgesvagrilvfpggkg
stvgsyvllnlrkngvapkaiinkktetiiavgaamaeiplvevrdekffeavktgdrvv
vnadegyvelie