PDB entry 2hi5

View 2hi5 on RCSB PDB site
Description: Model for bacteriophage fd from cryo-EM
Class: virus
Keywords: helix, helical VIRUS, structural protein, DNA binding protein, VIRUS
Deposited on 2006-06-29, released 2007-08-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-12-18, with a file datestamp of 2019-12-13.
Experiment type: EM
Resolution: 8 Å
R-factor: N/A
AEROSPACI score: -0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: coat protein b
    Species: Enterobacteria phage M13 [TaxId:10864]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2hi5a1

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hi5A (A:)
    aegddpakaafdslqasateyigyawamvvvivgatigiklfkkftskas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hi5A (A:)
    pakaafdslqasateyigyawamvvvivgatigiklfkkfts