PDB entry 2hhq

View 2hhq on RCSB PDB site
Description: O6-methyl-guanine:T pair in the polymerase-10 basepair position
Class: Transferase/DNA
Keywords: DNA polymerase I, DNA replication, Klenow fragment, Protein-DNA complex, O6-methyl-guanine, Transferase/DNA COMPLEX
Deposited on 2006-06-28, released 2006-12-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.212
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA polymerase I
    Species: Geobacillus stearothermophilus [TaxId:1422]
    Gene: polA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hhqa1, d2hhqa2
  • Chain 'B':
    Compound: 5'-d(*cp*ap*tp*(6og)p*cp*gp*ap*gp*tp*cp*ap*gp*g)-3'
    Species: synthetic, synthetic
  • Chain 'C':
    Compound: 5'-d(*gp*cp*cp*tp*gp*ap*cp*tp*cp*gp*tp*ap*tp*gp*a)-3'
    Species: synthetic, synthetic
  • Heterogens: SUC, SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hhqA (A:)
    kkmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
    fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
    kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrneqdrllve
    leqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefninspkqlgv
    ilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyiegllkvvr
    pdtkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwlifaadysq
    ielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakavnfgivygi
    sdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllhrrrylpdi
    tsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqvhdelilea
    pkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.