PDB entry 2hhp

View 2hhp on RCSB PDB site
Description: Structure of yeast poly(A) polymerase in a closed conformation.
Class: transferase
Keywords: template-independent RNA polymerase, TRANSFERASE
Deposited on 2006-06-28, released 2007-01-23
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.198
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: poly(a) polymerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PAP1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2hhpa1, d2hhpa2, d2hhpa3
  • Heterogens: FLC, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hhpA (A:)
    mssqkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaq
    rfvyevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvf
    dsllrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnl
    dekdlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlv
    aricqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrm
    pvitpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykf
    yleitaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccptedd
    yemiqdkygshktetalnalklvtdenkeeesikdapkaylstmyigldfnienkkekvd
    ihipctefvnlcrsfnedygdhkvfnlalrfvkgydlpdevfdenekrps
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hhpA (A:)
    qkvfgitgpvstvgataaenklndsliqelkkegsfeteqetanrvqvlkilqelaqrfv
    yevskkknmsdgmardaggkiftygsyrlgvhgpgsdidtlvvvpkhvtredfftvfdsl
    lrerkeldeiapvpdafvpiikikfsgisidlicarldqpqvplsltlsdknllrnldek
    dlralngtrvtdeilelvpkpnvfrialraiklwaqrravyanifgfpggvawamlvari
    cqlypnacsavilnrffiilsewnwpqpvilkpiedgplqvrvwnpkiyaqdrshrmpvi
    tpaypsmcathnitestkkvilqefvrgvqitndifsnkkswanlfekndfffrykfyle
    itaytrgsdeqhlkwsglveskvrllvmklevlagikiahpftkpfessyccpteddyem
    iqdkygshktetalnalkpkaylstmyigldfnkekvdihipctefvnlcrsfnedygdh
    kvfnlalrfvkgydlpdevfdenekrps