PDB entry 2hh6

View 2hh6 on RCSB PDB site
Description: Crystal structure of BH3980 (10176605) from BACILLUS HALODURANS at 2.04 A resolution
Class: STRUCTURAL GENOMICS, unknown function
Keywords: 10176605, BH3980, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI, unknown function
Deposited on 2006-06-27, released 2006-08-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.04 Å
R-factor: 0.225
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: BH3980 protein
  Species: Bacillus halodurans [TaxId:86665]
  Gene: 10176605
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9K5V7 (1-112)
    • modified residue (1)
    • modified residue (7)
    • modified residue (20)
    • modified residue (42)
    • modified residue (91)
    • modified residue (98)
  Domains in SCOPe 2.05: d2hh6a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hh6A (A:)
  gmsfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifg
  gildlfeegaaegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hh6A (A:)
  msfiekmigslndkrewkamearakalpkeyhhaykaiqkymwtsggptdwqdtkrifgg
  ildlfeegaaegkkvtdltgedvaafcdelmkdtktwmdkyrtklndsigrd