PDB entry 2hh0

View 2hh0 on RCSB PDB site
Description: Structure of an Anti-PrP Fab, P-Clone, in Complex with its Cognate Bovine Peptide Epitope.
Class: immune system
Keywords: prion, prp, fab, IMMUNE SYSTEM
Deposited on 2006-06-27, released 2006-12-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: N/A
AEROSPACI score: -1.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: Heavy Chain, P-Clone Fab, Chimera
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HH0 (0-216)
    Domains in SCOPe 2.08: d2hh0h1, d2hh0h2
  • Chain 'L':
    Compound: Light Chain, P-Clone Fab, Chimera
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2HH0 (0-209)
    Domains in SCOPe 2.08: d2hh0l1, d2hh0l2
  • Chain 'P':
    Compound: prion protein
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hh0H (H:)
    vqlleqsgaelvkpgasvklsctasgfniedsyihwvkqrpeqglewigridpedgetky
    apkfqgkatitadtssntaylhlrrltsedtaiyycgrgayyikedfwgqgttltvssas
    tkgpsvfplapsskaggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglys
    lssvvtvpssslgtqtyicnvnhkpsntkvdkkvepa
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hh0L (L:)
    lvmtqtpsslsaslgervsltcrasqdignnlnwiqqkpdgtikrliyatssldsgvpkr
    fsgsrsgsdysltisslesedfadyyclqhdtfpltfgggtkleikrtvaapsvfifpps
    deqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstltl
    skadyekhkvyacevthqglsspvtksfnr
    

  • Chain 'P':
    No sequence available.