PDB entry 2hgn

View 2hgn on RCSB PDB site
Description: NMR structure of the third qRRM domain of human hnRNP F
Class: RNA binding protein
Keywords: RNA recognition Motif, G-tract, G-quadruplex, alternative splicing, RNA BINDING PROTEIN
Deposited on 2006-06-27, released 2006-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: heterogeneous nuclear ribonucleoprotein F
    Species: Homo sapiens [TaxId:9606]
    Gene: HNRPF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hgna_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hgnA (A:)
    mgsshhhhhhssglvprgshmasmtggqqmgrgsgdseftvqsttghcvhmrglpykate
    ndiynffsplnpvrvhieigpdgrvtgeadvefatheeavaamskdranmqhryielfln
    sttgasngayssqvmqgmg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hgnA (A:)
    tghcvhmrglpykatendiynffsplnpvrvhieigpdgrvtgeadvefatheeavaams
    kdranmqhryielflnsttga