PDB entry 2hga

View 2hga on RCSB PDB site
Description: Solution NMR Structure of Conserved protein MTH1368, Northeast Structural Genomics Consortium Target TT821A
Class: structural genomics, unknown function
Keywords: Conserved protein MTH1368, GFT NMR, STRUCTURAL GENOMICS, PSI, PROTEIN STRUCTURE INITIATIVE, NORTHEAST STRUCTURAL GENOMICS CONSORTIUM, NESG, Hydrolase, Metal-binding, Metalloprotease, Protease, Transmembrane, Zinc b, UNKNOWN FUNCTION
Deposited on 2006-06-26, released 2006-07-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Conserved protein MTH1368
  Species: Methanothermobacter thermautotrophicus [TaxId:145262]
  Gene: MTH1368, MTH_1368
  Database cross-references and differences (RAF-indexed):
  • Uniprot O27421 (22-124)
  Domains in SCOPe 2.08: d2hgaa1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hgaA (A:)
  mgsshhhhhhssgrenlyfqghqpdgvqidsvvpgspaskvltpglviesingmptsnlt
  tysaalktisvgevinittdqgtfhlktgrnpnnssraymgirtsnhlrvrdsvasvlgd
  tlpfa
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hgaA (A:)
  qpdgvqidsvvpgspaskvltpglviesingmptsnlttysaalktisvgevinittdqg
  tfhlktgrnpnnssraymgirtsnhlrvrdsvasvlgdtlpfa