PDB entry 2hg2

View 2hg2 on RCSB PDB site
Description: Structure of Lactaldehyde Dehydrogenase
Class: oxidoreductase
Keywords: dehydrogenase, NAD dependent, OXIDOREDUCTASE
Deposited on 2006-06-26, released 2007-05-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Aldehyde dehydrogenase A
    Species: Escherichia coli [TaxId:562]
    Gene: aldA, ald
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hg2a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hg2A (A:)
    msvpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpew
    ealpaieraswlrkisagireraseisaliveeggkiqqlaevevaftadyidymaewar
    ryegeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpsef
    tpnnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimat
    aaknitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydq
    fvnrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvafggkaveg
    kgyyypptllldvrqemsimheetfgpvlpvvafdtledaismandsdygltssiytqnl
    nvamkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg2A (A:)
    vpvqhpmyidgqfvtwrgdawidvvnpateavisripdgqaedarkaidaaeraqpewea
    lpaieraswlrkisagireraseisaliveeggkiqqlaevevaftadyidymaewarry
    egeiiqsdrpgenillfkralgvttgilpwnfpffliarkmapalltgntivikpseftp
    nnaiafakivdeiglprgvfnlvlgrgetvgqelagnpkvamvsmtgsvsagekimataa
    knitkvclelggkapaivmddadlelavkaivdsrvinsgqvcncaervyvqkgiydqfv
    nrlgeamqavqfgnpaerndiamgplinaaalerveqkvaraveegarvafggkavegkg
    yyypptllldvrqemsimheetfgpvlpvvafdtledaismandsdygltssiytqnlnv
    amkaikglkfgetyinrenfeamqgfhagwrksgiggadgkhglheylqtqvvylqs