PDB entry 2hg0

View 2hg0 on RCSB PDB site
Description: Structure of the West Nile Virus envelope glycoprotein
Class: viral protein
Keywords: Virus/Viral Protein
Deposited on 2006-06-26, released 2006-11-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-12-01, with a file datestamp of 2009-11-27.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.261
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Envelope glycoprotein
    Species: West Nile virus [TaxId:11082]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hg0a1, d2hg0a2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hg0A (A:)
    fnclgmsnrdflegvsgatwvdlvlegdscvtimskdkptidvkmmnmeaanlaevrsyc
    ylatvsdlstkaacptmgeahndkradpafvcrqgvvdrgwgngcglfgkgsidtcakfa
    cstkaigrtilkenikyevaifvhgpttveshgnystqvgatqagrfsitpaapsytlkl
    geygevtvdceprsgidtnayyvmtvgtktflvhrewfmdlnlpwssagstvwrnretlm
    efeephatkqsvialgsqegalhqalagaipvefssntvkltsghlkcrvkmeklqlkgt
    tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp
    fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhksgshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hg0A (A:)
    fnclgmsnrdflegvsgatwvdlvlegdscvtimskdkptidvkmmnmeaanlaevrsyc
    ylatvsdlstkaacptmgeahndkradpafvcrqgvvdrgwgngcglfgkgsidtcakfa
    cstkaigrtilkenikyevaifvhgpttveshgnystqvgatqagrfsitpaapsytlkl
    geygevtvdceprsgidtnayyvmtvgtktflvhrewfmdlnlpwssagstvwrnretlm
    efeephatkqsvialgsqegalhqalagaipvefssntvkltsghlkcrvkmeklqlkgt
    tygvcskafkflgtpadtghgtvvlelqytgtdgpckvpissvaslndltpvgrlvtvnp
    fvsvatanakvlieleppfgdsyivvgrgeqqinhhwhks