PDB entry 2hfx

View 2hfx on RCSB PDB site
Description: Structural and kinetic analysis of proton shuttle residues in the active site of human carbonic anhydrase III
Class: lyase
Keywords: proton shuttle, HCA III, proton transfer, LYASE
Deposited on 2006-06-26, released 2007-05-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-12-21, with a file datestamp of 2011-12-16.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.205
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Carbonic anhydrase 3
    Species: Homo sapiens [TaxId:9606]
    Gene: CA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07451 (Start-259)
      • engineered (63)
      • engineered (181)
      • engineered (186)
    Domains in SCOPe 2.06: d2hfxa_
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hfxA (A:)
    makewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktil
    nnghtcrvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhl
    vhwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdp
    sslfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvpl
    vsnwrppqpinnrvvrasfk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hfxA (A:)
    akewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktiln
    nghtcrvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
    hwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdps
    slfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvplv
    snwrppqpinnrvvrasfk