PDB entry 2hfd

View 2hfd on RCSB PDB site
Description: NMR structure of protein Hydrogenase-1 operon protein hyaE from Escherichia coli: Northeast Structural Genomics Consortium Target ER415
Class: structural genomics, unknown function
Keywords: PROTEIN STRUCTURE, NESGC, ALFA-BETA, Structural Genomics, PSI-2, Protein Structure Initiative, Northeast Structural Genomics Consortium
Deposited on 2006-06-23, released 2006-08-22
The last revision prior to the SCOP 1.73 freeze date was dated 2006-08-22, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hydrogenase-1 operon protein hyaE
  Species: Escherichia coli
  Gene: hyaE
  Database cross-references and differences (RAF-indexed):
  • Uniprot P19931 (0-131)
  Domains in SCOP 1.73: d2hfda1

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >2hfdA (A:)
  msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
  llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
  rglvepqqeraslehhhhhh
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >2hfdA (A:)
  msndtpfdalwqrmlargwtpvsesrlddwltqapdgvvllssdpkrtpevsdnpvmige
  llrefpdytwqvaiadleqseaigdrfgvfrfpatlvftggnyrgvlngihpwaelinlm
  rglvepqqeras