PDB entry 2her

View 2her on RCSB PDB site
Description: Cryptosporidium parvum putative polyprenyl pyrophosphate synthase (cgd4_2550) in complex with zoledronate
Class: transferase
Keywords: Farnesyl diphosphate synthase, structural genomics, Structural Genomics Consortium, SGC, TRANSFERASE
Deposited on 2006-06-21, released 2006-07-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-10, with a file datestamp of 2009-02-06.
Experiment type: XRAY
Resolution: 2.37 Å
R-factor: 0.202
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: farnesyl pyrophosphate synthase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2hera_
  • Chain 'B':
    Compound: farnesyl pyrophosphate synthase
    Species: Cryptosporidium parvum [TaxId:5807]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2herb_
  • Heterogens: MG, ZOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2herA (A:)
    mgsshhhhhhssgrenlyfqgeydytdfinyydkfkvivynvlkklplndeirkpvieyy
    lncidynvkkgkhirgkilvlisslssaysnikrdsiyllgwvveaiqaliliaddimds
    gkfrrgapcwyivhgqsnaindifflkmlslslifelssvfgndivmkiqkiynesifft
    vlgqhldlsyfdlskadkiseryfsmvemktsrytfympvffgltlseiqvssaqlnlie
    ailyklgefyqvhndvsdylfndsnaddicrfkltwplqksfeiadeemklkisenygkn
    sslvkdcynllkinehyleyqrnaldyliklvkditddslqkvfihlihqiselitnsrs
    nadsnnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2herA (A:)
    ydytdfinyydkfkvivynvlkklplndeirkpvieyylncidynvkkgkhirgkilvli
    sslssaysnikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaind
    ifflkmlslslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiser
    yfsmvemktsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfn
    dsnaddicrfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqr
    naldyliklvkditddslqkvfihlihqiselitn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2herB (B:)
    mgsshhhhhhssgrenlyfqgeydytdfinyydkfkvivynvlkklplndeirkpvieyy
    lncidynvkkgkhirgkilvlisslssaysnikrdsiyllgwvveaiqaliliaddimds
    gkfrrgapcwyivhgqsnaindifflkmlslslifelssvfgndivmkiqkiynesifft
    vlgqhldlsyfdlskadkiseryfsmvemktsrytfympvffgltlseiqvssaqlnlie
    ailyklgefyqvhndvsdylfndsnaddicrfkltwplqksfeiadeemklkisenygkn
    sslvkdcynllkinehyleyqrnaldyliklvkditddslqkvfihlihqiselitnsrs
    nadsnnsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >2herB (B:)
    ydytdfinyydkfkvivynvlkklpvieyylncidynvkkgkhirgkilvlisslssays
    nikrdsiyllgwvveaiqaliliaddimdsgkfrrgapcwyivhgqsnaindifflkmls
    lslifelssvfgndivmkiqkiynesifftvlgqhldlsyfdlskadkiseryfsmvemk
    tsrytfympvffgltlseiqvssaqlnlieailyklgefyqvhndvsdylfndsnaddic
    rfkltwplqksfeiadeemklkisenygknsslvkdcynllkinehyleyqrnaldylik
    lvkditddslqkvfihlihqiselitnsrsn