PDB entry 2hei

View 2hei on RCSB PDB site
Description: Crystal structure of human RAB5B in complex with GDP
Class: transport protein
Keywords: G-PROTEIN, RAB, Structural Genomics, Structural Genomics Consortium, SGC, TRANSPORT PROTEIN
Deposited on 2006-06-21, released 2006-07-04
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: 0.262
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ras-related protein Rab-5B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2heia_
  • Chain 'B':
    Compound: Ras-related protein Rab-5B
    Species: Homo sapiens [TaxId:9606]
    Gene: RAB5B
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2heib_
  • Heterogens: GDP, D1D, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2heiA (A:)
    gsaskicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqsvclddttvkfe
    iwdtagqeryhslapmyyrgaqaaivvyditnqetfaraktwvkelqrqaspsivialag
    nkadlankrmveyeeaqayaddnsllfmetsaktamnvndlflaiakklpksepqnlgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2heiA (A:)
    icqfklvllgesavgksslvlrfvkgqfheyqestigaafltqsvcltvkfeiwdtagqe
    ryhslapmyyrgaqaaivvyditnqetfaraktwvkelqrqaspsivialagnkadlank
    rmveyeeaqayaddnsllfmetsaktamnvndlflaiakklpk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2heiB (B:)
    gsaskicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqsvclddttvkfe
    iwdtagqeryhslapmyyrgaqaaivvyditnqetfaraktwvkelqrqaspsivialag
    nkadlankrmveyeeaqayaddnsllfmetsaktamnvndlflaiakklpksepqnlgg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2heiB (B:)
    kicqfklvllgesavgksslvlrfvkgqfheyqestigaafltqsvclttvkfeiwdtag
    qeryhslapmyyrgaqaaivvyditnqetfaraktwvkelqrqaspsivialagnkadla
    nkrmveyeeaqayaddnsllfmetsaktamnvndlflaiakklpk