PDB entry 2heb

View 2heb on RCSB PDB site
Description:
Deposited on 1997-09-16, released 1998-01-28
The last revision prior to the SCOP 1.71 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.124
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.71: d2heb__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2heb_ (-)
    kvfercelartlkrlgmdgyrgaslanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv