PDB entry 2heb

View 2heb on RCSB PDB site
Description: contribution of water molecules in the interior of a protein to the conformational stability
Deposited on 1997-09-16, released 1998-01-28
The last revision prior to the SCOP 1.67 freeze date was dated 1998-01-28, with a file datestamp of 1998-01-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.124
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.67: d2heb__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2heb_ (-)
  kvfercelartlkrlgmdgyrgaslanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
  vrqyvqgcgv