PDB entry 2hea

View 2hea on RCSB PDB site
Description: contribution of water molecules in the interior of a protein to the conformational stability
Deposited on 1997-09-16, released 1998-01-14
The last revision prior to the SCOP 1.61 freeze date was dated 1998-01-14, with a file datestamp of 1998-01-14.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.156
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.61: d2hea__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hea_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgarawvawrnrcqnrd
    vrqyvqgcgv