PDB entry 2he4

View 2he4 on RCSB PDB site
Description: The crystal structure of the second PDZ domain of human NHERF-2 (SLC9A3R2) interacting with a mode 1 PDZ binding motif
Class: structural genomics, unknown function
Keywords: Phosphorylation, Structural Genomics, Structural Genomics Consortium, SGC, UNKNOWN FUNCTION
Deposited on 2006-06-21, released 2006-07-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.132
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Na(+)/H(+) exchange regulatory cofactor NHE-RF2
    Species: Homo sapiens [TaxId:9606]
    Gene: SLC9A3R2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15599 (2-85)
      • cloning artifact (0-1)
      • engineered (84)
      • cloning artifact (86-89)
    Domains in SCOPe 2.08: d2he4a1, d2he4a2, d2he4a3
  • Heterogens: EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2he4A (A:)
smlrprlchlrkgpqgygfnlhsdksrpgqyirsvdpgspaarsglraqdrlievngqnv
eglrhaevvasikaredearllvvgpstrl