PDB entry 2hds

View 2hds on RCSB PDB site
Description: AmpC beta-lactamase in complex with 4-Methanesulfonylamino benzoic acid
Class: hydrolase
Keywords: AmpC beta-lactamase fragment-based drug design
Deposited on 2006-06-20, released 2006-11-07
The last revision prior to the SCOP 1.75 freeze date was dated 2006-12-05, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.16 Å
R-factor: 0.109
AEROSPACI score: 1.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hdsa1
  • Chain 'B':
    Compound: Beta-lactamase
    Species: Escherichia coli
    Gene: AMPC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2hdsb1
  • Heterogens: SUC, PO4, NA, 4MB, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hdsA (A:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2hdsB (B:)
    apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
    svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
    evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
    lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
    nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdnkialaarpvkaitp
    ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq